SCOP 1.63: Domain d1h3vb1: 1h3v B:238-341

Lineage for d1h3vb1 (1h3v B:238-341)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fc (human) IgG1 class [49120] (14 PDB entries)

8. Domain d1h3vb1: 1h3v B:238-341 [76663]

Details for d1h3vb1

PDB Entry: 1h3v, 3.1 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121

SCOP Domain Sequences for d1h3vb1:

Sequence, based on SEQRES records:

>d1h3vb1 b.1.1.2 (B:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records):

>d1h3vb1 b.1.1.2 (B:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvnaktkpreqqyst
yrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3vb1:

• d1h3vb1 is new in SCOP 1.63
  
• d1h3vb1 appears in SCOP 1.65
  
• d1h3vb1 appears in the current release, SCOPe 2.08