SCOP 1.73: Domain d1h3va2: 1h3v A:342-445

Lineage for d1h3va2 (1h3v A:342-445)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)

8. Domain d1h3va2: 1h3v A:342-445 [76662]
   Other proteins in same PDB: d1h3va1, d1h3vb1

Details for d1h3va2

PDB Entry: 1h3v, 3.1 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOP Domain Sequences for d1h3va2:

Sequence; same for both SEQRES and ATOM records:

>d1h3va2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

Timeline for d1h3va2:

• d1h3va2 first appeared in SCOP 1.63
  
• d1h3va2 appears in SCOP 1.71
  
• d1h3va2 appears in SCOP 1.75
  
• d1h3va2 appears in the current release, SCOPe 2.07