Lineage for d1h3va1 (1h3v A:238-341)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516071Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1516072Species Human (Homo sapiens) [TaxId:9606] [88585] (35 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1516122Domain d1h3va1: 1h3v A:238-341 [76661]
    Other proteins in same PDB: d1h3va2, d1h3vb2
    part of a Fc

Details for d1h3va1

PDB Entry: 1h3v (more details), 3.1 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d1h3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3va1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1h3va1:

Click to download the PDB-style file with coordinates for d1h3va1.
(The format of our PDB-style files is described here.)

Timeline for d1h3va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3va2