SCOP 1.65: Domain d1h3va1: 1h3v A:238-341

Lineage for d1h3va1 (1h3v A:238-341)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries)

8. Domain d1h3va1: 1h3v A:238-341 [76661]
   Other proteins in same PDB: d1h3va2, d1h3vb2

Details for d1h3va1

PDB Entry: 1h3v, 3.1 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121

SCOP Domain Sequences for d1h3va1:

Sequence; same for both SEQRES and ATOM records:

>d1h3va1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3va1:

• d1h3va1 first appeared in SCOP 1.63
  
• d1h3va1 appears in SCOP 1.67
  
• d1h3va1 appears in the current release, SCOPe 2.08