Lineage for d1h3ua2 (1h3u A:342-445)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748702Domain d1h3ua2: 1h3u A:342-445 [76658]
    Other proteins in same PDB: d1h3ua1, d1h3ub1
    part of a Fc

Details for d1h3ua2

PDB Entry: 1h3u (more details), 2.4 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (m3n2f)2
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d1h3ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ua2 b.1.1.2 (A:342-445) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d1h3ua2:

Click to download the PDB-style file with coordinates for d1h3ua2.
(The format of our PDB-style files is described here.)

Timeline for d1h3ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ua1