SCOPe 2.03: Domain d1h3tb1: 1h3t B:238-341

Lineage for d1h3tb1 (1h3t B:238-341)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1h3tb1: 1h3t B:238-341 [76655]
   Other proteins in same PDB: d1h3ta2, d1h3tb2
   part of a Fc
   complexed with bma

Details for d1h3tb1

PDB Entry: 1h3t, 2.4 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (mn2f)2

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d1h3tb1:

Sequence, based on SEQRES records:

>d1h3tb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records):

>d1h3tb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshqkfnwyvdgvqvhnaktkpreqqnstyrv
vsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3tb1:

• d1h3tb1 first appeared in SCOP 1.63
  
• d1h3tb1 appears in SCOPe 2.02
  
• d1h3tb1 appears in SCOPe 2.04
  
• d1h3tb1 appears in the current release, SCOPe 2.08