Lineage for d1h3tb1 (1h3t B:238-341)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655820Domain d1h3tb1: 1h3t B:238-341 [76655]
    Other proteins in same PDB: d1h3ta2, d1h3tb2
    part of a Fc
    complexed with afl, bma, nag

Details for d1h3tb1

PDB Entry: 1h3t (more details), 2.4 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (mn2f)2
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOP Domain Sequences for d1h3tb1:

Sequence, based on SEQRES records: (download)

>d1h3tb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records): (download)

>d1h3tb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshqkfnwyvdgvqvhnaktkpreqqnstyrv
vsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1h3tb1:

Click to download the PDB-style file with coordinates for d1h3tb1.
(The format of our PDB-style files is described here.)

Timeline for d1h3tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3tb2