Lineage for d1h32b_ (1h32 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691279Protein Mono-heme c-type cytochrome SoxX [81675] (1 species)
  7. 2691280Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries)
  8. 2691281Domain d1h32b_: 1h32 B: [76620]
    Other proteins in same PDB: d1h32a1, d1h32a2
    complexed with edo, hec

Details for d1h32b_

PDB Entry: 1h32 (more details), 1.5 Å

PDB Description: reduced soxax complex from rhodovulum sulfidophilum
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d1h32b_:

Sequence, based on SEQRES records: (download)

>d1h32b_ a.3.1.1 (B:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq

Sequence, based on observed residues (ATOM records): (download)

>d1h32b_ a.3.1.1 (B:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemqfpgtvgps
ldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirplmta
gqiedvvaylmtltq

SCOPe Domain Coordinates for d1h32b_:

Click to download the PDB-style file with coordinates for d1h32b_.
(The format of our PDB-style files is described here.)

Timeline for d1h32b_: