Lineage for d1h32a2 (1h32 A:151-261)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 210231Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 210232Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cyteine persulfide(cys sulfane) haem coordination
  7. 210233Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (3 PDB entries)
  8. 210235Domain d1h32a2: 1h32 A:151-261 [76619]
    Other proteins in same PDB: d1h32b_
    complexed with css, edo, hec

Details for d1h32a2

PDB Entry: 1h32 (more details), 1.5 Å

PDB Description: reduced soxax complex from rhodovulum sulfidophilum

SCOP Domain Sequences for d1h32a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h32a2 a.3.1.8 (A:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum}
idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna
rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn

SCOP Domain Coordinates for d1h32a2:

Click to download the PDB-style file with coordinates for d1h32a2.
(The format of our PDB-style files is described here.)

Timeline for d1h32a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h32a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1h32b_