Lineage for d1h31h_ (1h31 H:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904994Protein Mono-heme c-type cytochrome SoxX [81675] (1 species)
  7. 904995Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries)
  8. 905005Domain d1h31h_: 1h31 H: [76617]
    Other proteins in same PDB: d1h31a1, d1h31a2, d1h31c1, d1h31c2, d1h31e1, d1h31e2, d1h31g1, d1h31g2
    complexed with hec

Details for d1h31h_

PDB Entry: 1h31 (more details), 2.55 Å

PDB Description: Oxidised SoxAX complex from Rhodovulum sulfidophilum
PDB Compounds: (H:) cytochrome c

SCOPe Domain Sequences for d1h31h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h31h_ a.3.1.1 (H:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq

SCOPe Domain Coordinates for d1h31h_:

Click to download the PDB-style file with coordinates for d1h31h_.
(The format of our PDB-style files is described here.)

Timeline for d1h31h_: