Lineage for d1h31h_ (1h31 H:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 210093Protein Mono-heme c-type cytochrome SoxX [81675] (1 species)
  7. 210094Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (3 PDB entries)
  8. 210100Domain d1h31h_: 1h31 H: [76617]
    Other proteins in same PDB: d1h31a1, d1h31a2, d1h31c1, d1h31c2, d1h31e1, d1h31e2, d1h31g1, d1h31g2
    complexed with css, hec

Details for d1h31h_

PDB Entry: 1h31 (more details), 2.55 Å

PDB Description: Oxidised SoxAX complex from Rhodovulum sulfidophilum

SCOP Domain Sequences for d1h31h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h31h_ a.3.1.1 (H:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq

SCOP Domain Coordinates for d1h31h_:

Click to download the PDB-style file with coordinates for d1h31h_.
(The format of our PDB-style files is described here.)

Timeline for d1h31h_: