SCOPe 2.08: Domain d1h31g1: 1h31 G:1-150

Lineage for d1h31g1 (1h31 G:1-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
   two-domain cytochrome c with novel domain arrangement

6. Protein Di-heme cytochrome c SoxA [81678] (1 species)
   cysteine persulfide(cys sulfane) heme coordination

7. Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)

8. Domain d1h31g1: 1h31 G:1-150 [76615]
   Other proteins in same PDB: d1h31b_, d1h31d_, d1h31f_, d1h31h_
   complexed with hec

Details for d1h31g1

PDB Entry: 1h31, 2.55 Å

PDB Description: Oxidised SoxAX complex from Rhodovulum sulfidophilum

PDB Compounds: (G:) diheme cytochrome c

SCOPe Domain Sequences for d1h31g1:

Sequence; same for both SEQRES and ATOM records:

>d1h31g1 a.3.1.8 (G:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

Timeline for d1h31g1:

• d1h31g1 first appeared in SCOP 1.63
  
• d1h31g1 appears in SCOPe 2.07