Class a: All alpha proteins [46456] (179 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins) |
Protein Mono-heme c-type cytochrome SoxX [81675] (1 species) |
Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (3 PDB entries) |
Domain d1h31f_: 1h31 F: [76614] Other proteins in same PDB: d1h31a1, d1h31a2, d1h31c1, d1h31c2, d1h31e1, d1h31e2, d1h31g1, d1h31g2 |
PDB Entry: 1h31 (more details), 2.55 Å
SCOP Domain Sequences for d1h31f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h31f_ a.3.1.1 (F:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum} aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl mtagqiedvvaylmtltq
Timeline for d1h31f_: