Lineage for d1h31d_ (1h31 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760914Protein Mono-heme c-type cytochrome SoxX [81675] (1 species)
  7. 760915Species Rhodovulum sulfidophilum [TaxId:35806] [81676] (4 PDB entries)
  8. 760923Domain d1h31d_: 1h31 D: [76611]
    Other proteins in same PDB: d1h31a1, d1h31a2, d1h31c1, d1h31c2, d1h31e1, d1h31e2, d1h31g1, d1h31g2

Details for d1h31d_

PDB Entry: 1h31 (more details), 2.55 Å

PDB Description: Oxidised SoxAX complex from Rhodovulum sulfidophilum
PDB Compounds: (D:) cytochrome c

SCOP Domain Sequences for d1h31d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h31d_ a.3.1.1 (D:) Mono-heme c-type cytochrome SoxX {Rhodovulum sulfidophilum [TaxId: 35806]}
aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
mtagqiedvvaylmtltq

SCOP Domain Coordinates for d1h31d_:

Click to download the PDB-style file with coordinates for d1h31d_.
(The format of our PDB-style files is described here.)

Timeline for d1h31d_: