![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein) contains N- and C-terminal extensions to the common fold involved in the oligomerization |
![]() | Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species) forms an undecameric ring structure; binds to ssDNA and dsDNA |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82647] (3 PDB entries) |
![]() | Domain d1h2io_: 1h2i O: [76564] |
PDB Entry: 1h2i (more details), 2.7 Å
SCOPe Domain Sequences for d1h2io_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2io_ d.50.1.3 (O:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens) [TaxId: 9606]} lcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyng wahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekar keavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveea rynscr
Timeline for d1h2io_: