Lineage for d1h2if_ (1h2i F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648324Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1648325Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1648472Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein)
    contains N- and C-terminal extensions to the common fold involved in the oligomerization
  6. 1648473Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species)
    forms an undecameric ring structure; binds to ssDNA and dsDNA
  7. 1648474Species Human (Homo sapiens) [TaxId:9606] [82647] (2 PDB entries)
  8. 1648491Domain d1h2if_: 1h2i F: [76555]

Details for d1h2if_

PDB Entry: 1h2i (more details), 2.7 Å

PDB Description: human rad52 protein, n-terminal domain
PDB Compounds: (F:) DNA repair protein rad52 homolog

SCOPe Domain Sequences for d1h2if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2if_ d.50.1.3 (F:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens) [TaxId: 9606]}
lcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyng
wahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekar
keavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveea
rynscr

SCOPe Domain Coordinates for d1h2if_:

Click to download the PDB-style file with coordinates for d1h2if_.
(The format of our PDB-style files is described here.)

Timeline for d1h2if_: