![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.50: dsRBD-like [54767] (3 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein) contains N- and C-terminal extentions to the common fold involved in the oligomerisation |
![]() | Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species) forms an undecameric ring structure; binds to ssDNA and dsDNA |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82647] (2 PDB entries) |
![]() | Domain d1h2ie_: 1h2i E: [76554] |
PDB Entry: 1h2i (more details), 2.7 Å
SCOP Domain Sequences for d1h2ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ie_ d.50.1.3 (E:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens)} lcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyng wahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekar keavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveea rynscr
Timeline for d1h2ie_: