Lineage for d1h2ib_ (1h2i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946987Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein)
    contains N- and C-terminal extensions to the common fold involved in the oligomerization
  6. 2946988Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species)
    forms an undecameric ring structure; binds to ssDNA and dsDNA
  7. 2946989Species Human (Homo sapiens) [TaxId:9606] [82647] (3 PDB entries)
  8. 2947013Domain d1h2ib_: 1h2i B: [76551]

Details for d1h2ib_

PDB Entry: 1h2i (more details), 2.7 Å

PDB Description: human rad52 protein, n-terminal domain
PDB Compounds: (B:) DNA repair protein rad52 homolog

SCOPe Domain Sequences for d1h2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ib_ d.50.1.3 (B:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens) [TaxId: 9606]}
lcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyng
wahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekar
keavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveea
rynscr

SCOPe Domain Coordinates for d1h2ib_:

Click to download the PDB-style file with coordinates for d1h2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1h2ib_: