SCOP 1.65: Domain d1h28b2: 1h28 B:310-432

Lineage for d1h28b2 (1h28 B:310-432)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (18 PDB entries)

8. Domain d1h28b2: 1h28 B:310-432 [76542]
   Other proteins in same PDB: d1h28a_, d1h28c_

Details for d1h28b2

PDB Entry: 1h28, 2.8 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p107

SCOP Domain Sequences for d1h28b2:

Sequence; same for both SEQRES and ATOM records:

>d1h28b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1h28b2:

• d1h28b2 first appeared in SCOP 1.63
  
• d1h28b2 appears in SCOP 1.67
  
• d1h28b2 appears in the current release, SCOPe 2.08