Lineage for d1h27c_ (1h27 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434070Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434071Species Human (Homo sapiens) [TaxId:9606] [88856] (335 PDB entries)
    Uniprot P24941
  8. 1434349Domain d1h27c_: 1h27 C: [76537]
    Other proteins in same PDB: d1h27b1, d1h27b2, d1h27d1, d1h27d2
    complex with cyclin and an 11-residue recruitment peptide from p27

Details for d1h27c_

PDB Entry: 1h27 (more details), 2.2 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p27
PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d1h27c_:

Sequence, based on SEQRES records: (download)

>d1h27c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d1h27c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpa
rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d1h27c_:

Click to download the PDB-style file with coordinates for d1h27c_.
(The format of our PDB-style files is described here.)

Timeline for d1h27c_: