SCOP 1.73: Domain d1h27c_: 1h27 C:

Lineage for d1h27c_ (1h27 C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries)

8. Domain d1h27c_: 1h27 C: [76537]
   Other proteins in same PDB: d1h27b1, d1h27b2, d1h27d1, d1h27d2
   complex with cyclin and an 11-residue recruitment peptide from p27
   complexed with tpo

Details for d1h27c_

PDB Entry: 1h27, 2.2 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p27

PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d1h27c_:

Sequence, based on SEQRES records:

>d1h27c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records):

>d1h27c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpa
rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Timeline for d1h27c_:

• d1h27c_ first appeared in SCOP 1.63
  
• d1h27c_ appears in SCOP 1.71
  
• d1h27c_ appears in SCOP 1.75
  
• d1h27c_ appears in the current release, SCOPe 2.08, called d1h27c1