SCOP 1.73: Domain d1h26d1: 1h26 D:175-309

Lineage for d1h26d1 (1h26 D:175-309)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries)

8. Domain d1h26d1: 1h26 D:175-309 [76532]
   Other proteins in same PDB: d1h26a_, d1h26c_

Details for d1h26d1

PDB Entry: 1h26, 2.24 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p53

PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d1h26d1:

Sequence; same for both SEQRES and ATOM records:

>d1h26d1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1h26d1:

• d1h26d1 first appeared in SCOP 1.63
  
• d1h26d1 appears in SCOP 1.71
  
• d1h26d1 appears in SCOP 1.75
  
• d1h26d1 appears in the current release, SCOPe 2.08