Lineage for d1h26c_ (1h26 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1042555Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1042556Species Human (Homo sapiens) [TaxId:9606] [88856] (204 PDB entries)
    Uniprot P24941
  8. 1042719Domain d1h26c_: 1h26 C: [76531]
    Other proteins in same PDB: d1h26b1, d1h26b2, d1h26d1, d1h26d2
    complex with cyclin and an 11-residue recruitment peptide from p53

Details for d1h26c_

PDB Entry: 1h26 (more details), 2.24 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p53
PDB Compounds: (C:) Cell division protein kinase 2

SCOPe Domain Sequences for d1h26c_:

Sequence, based on SEQRES records: (download)

>d1h26c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d1h26c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtvvppldedgrsllsqmlh
ydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d1h26c_:

Click to download the PDB-style file with coordinates for d1h26c_.
(The format of our PDB-style files is described here.)

Timeline for d1h26c_: