SCOPe 2.07: Domain d1h26b2: 1h26 B:310-432

Lineage for d1h26b2 (1h26 B:310-432)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d1h26b2: 1h26 B:310-432 [76530]
   Other proteins in same PDB: d1h26a1, d1h26a2, d1h26c1, d1h26c2

Details for d1h26b2

PDB Entry: 1h26, 2.24 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p53

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1h26b2:

Sequence; same for both SEQRES and ATOM records:

>d1h26b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1h26b2:

• d1h26b2 first appeared in SCOP 1.63
  
• d1h26b2 appears in SCOPe 2.06
  
• d1h26b2 appears in the current release, SCOPe 2.08