Lineage for d1h25b1 (1h25 B:175-309)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540337Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 540338Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 540339Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 540350Protein Cyclin A [47956] (2 species)
  7. 540354Species Human (Homo sapiens) [TaxId:9606] [47957] (29 PDB entries)
  8. 540441Domain d1h25b1: 1h25 B:175-309 [76523]
    Other proteins in same PDB: d1h25a_, d1h25c_

Details for d1h25b1

PDB Entry: 1h25 (more details), 2.5 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from retinoblastoma-associated protein

SCOP Domain Sequences for d1h25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h25b1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOP Domain Coordinates for d1h25b1:

Click to download the PDB-style file with coordinates for d1h25b1.
(The format of our PDB-style files is described here.)

Timeline for d1h25b1: