Lineage for d1h1va1 (1h1v A:5-146)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 245988Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 245989Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 245990Protein Actin [53073] (6 species)
  7. 246009Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (10 PDB entries)
  8. 246024Domain d1h1va1: 1h1v A:5-146 [76501]
    Other proteins in same PDB: d1h1vg1, d1h1vg2, d1h1vg3

Details for d1h1va1

PDB Entry: 1h1v (more details), 3 Å

PDB Description: gelsolin g4-g6/actin complex

SCOP Domain Sequences for d1h1va1:

Sequence, based on SEQRES records: (download)

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1h1va1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhmvgmgqkdsyvgdeaqskrgiltl
kypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetf
nvpamyvaiqavlslyasg

SCOP Domain Coordinates for d1h1va1:

Click to download the PDB-style file with coordinates for d1h1va1.
(The format of our PDB-style files is described here.)

Timeline for d1h1va1: