Lineage for d1h1rb2 (1h1r B:310-432)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644055Protein Cyclin A [47956] (2 species)
  7. 644131Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries)
  8. 644133Domain d1h1rb2: 1h1r B:310-432 [76491]
    Other proteins in same PDB: d1h1ra_, d1h1rc_

Details for d1h1rb2

PDB Entry: 1h1r (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6086
PDB Compounds: (B:) cyclin a2

SCOP Domain Sequences for d1h1rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1rb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1h1rb2:

Click to download the PDB-style file with coordinates for d1h1rb2.
(The format of our PDB-style files is described here.)

Timeline for d1h1rb2: