Lineage for d1h1qb2 (1h1q B:310-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331505Domain d1h1qb2: 1h1q B:310-432 [76485]
    Other proteins in same PDB: d1h1qa1, d1h1qa2, d1h1qc1, d1h1qc2
    complexed with 2a6

Details for d1h1qb2

PDB Entry: 1h1q (more details), 2.5 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6094
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1h1qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1qb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1h1qb2:

Click to download the PDB-style file with coordinates for d1h1qb2.
(The format of our PDB-style files is described here.)

Timeline for d1h1qb2: