SCOPe 2.04: Domain d1h1pd2: 1h1p D:310-432

Lineage for d1h1pd2 (1h1p D:310-432)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d1h1pd2: 1h1p D:310-432 [76482]
   Other proteins in same PDB: d1h1pa_, d1h1pc_
   complexed with cmg

Details for d1h1pd2

PDB Entry: 1h1p, 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu2058

PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d1h1pd2:

Sequence; same for both SEQRES and ATOM records:

>d1h1pd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1h1pd2:

• d1h1pd2 first appeared in SCOP 1.63
  
• d1h1pd2 appears in SCOPe 2.03
  
• d1h1pd2 appears in SCOPe 2.05
  
• d1h1pd2 appears in the current release, SCOPe 2.08