Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (23 PDB entries) probably orthologous to the mouse I-E group |
Domain d1h15e1: 1h15 E:93-190 [76460] Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b2, d1h15d1, d1h15d2, d1h15e2 complexed with nag, ndg |
PDB Entry: 1h15 (more details), 3.1 Å
SCOP Domain Sequences for d1h15e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h15e1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group} rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1h15e1: