SCOP 1.73: Domain d1h15b2: 1h15 B:2-92

Lineage for d1h15b2 (1h15 B:2-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)

8. Domain d1h15b2: 1h15 B:2-92 [76457]
   Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b1, d1h15d1, d1h15d2, d1h15e1

Details for d1h15b2

PDB Entry: 1h15, 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase

PDB Compounds: (B:) hla class II histocompatibility antigen, dr beta 1 chain

SCOP Domain Sequences for d1h15b2:

Sequence; same for both SEQRES and ATOM records:

>d1h15b2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

Timeline for d1h15b2:

• d1h15b2 first appeared in SCOP 1.63
  
• d1h15b2 appears in SCOP 1.71
  
• d1h15b2 appears in SCOP 1.75
  
• d1h15b2 appears in the current release, SCOPe 2.08