Lineage for d1h15b2 (1h15 B:2-92)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600593Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 600603Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 600621Domain d1h15b2: 1h15 B:2-92 [76457]
    Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b1, d1h15d1, d1h15d2, d1h15e1

Details for d1h15b2

PDB Entry: 1h15 (more details), 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase

SCOP Domain Sequences for d1h15b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h15b2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1h15b2:

Click to download the PDB-style file with coordinates for d1h15b2.
(The format of our PDB-style files is described here.)

Timeline for d1h15b2: