Lineage for d1h15a2 (1h15 A:3-81)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409588Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 409598Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (11 PDB entries)
  8. 409613Domain d1h15a2: 1h15 A:3-81 [76455]
    Other proteins in same PDB: d1h15a1, d1h15b1, d1h15b2, d1h15d1, d1h15e1, d1h15e2

Details for d1h15a2

PDB Entry: 1h15 (more details), 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase

SCOP Domain Sequences for d1h15a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h15a2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1h15a2:

Click to download the PDB-style file with coordinates for d1h15a2.
(The format of our PDB-style files is described here.)

Timeline for d1h15a2: