SCOPe 2.02: Domain d1h15a1: 1h15 A:82-182

Lineage for d1h15a1 (1h15 A:82-182)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1h15a1: 1h15 A:82-182 [76454]
   Other proteins in same PDB: d1h15a2, d1h15b1, d1h15b2, d1h15d2, d1h15e1, d1h15e2
   protein/DNA complex; complexed with nag

Details for d1h15a1

PDB Entry: 1h15, 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1h15a1:

Sequence; same for both SEQRES and ATOM records:

>d1h15a1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1h15a1:

• d1h15a1 first appeared in SCOP 1.63
  
• d1h15a1 appears in SCOPe 2.01
  
• d1h15a1 appears in SCOPe 2.03
  
• d1h15a1 appears in the current release, SCOPe 2.08