SCOP 1.63: Domain d1h0md1: 1h0m D:170-234

Lineage for d1h0md1 (1h0m D:170-234)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries)

8. Domain d1h0md1: 1h0m D:170-234 [76448]
   Other proteins in same PDB: d1h0ma2, d1h0mb2, d1h0mc2, d1h0md2
   complexed with hsl, mse, ooa

Details for d1h0md1

PDB Entry: 1h0m, 3 Å

PDB Description: three-dimensional structure of the quorum sensing protein trar bound to its autoinducer and to its target dna

SCOP Domain Sequences for d1h0md1:

Sequence; same for both SEQRES and ATOM records:

>d1h0md1 a.4.6.2 (D:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens}
daawldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalai
rrkli

Timeline for d1h0md1:

• d1h0md1 is new in SCOP 1.63
  
• d1h0md1 appears in SCOP 1.65
  
• d1h0md1 appears in the current release, SCOPe 2.08