Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain automatically mapped to Pfam PF03472 |
Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein) |
Protein Transcription factor TraR, N-terminal domain [75518] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries) |
Domain d1h0mc2: 1h0m C:1-164 [76447] Other proteins in same PDB: d1h0ma1, d1h0mb1, d1h0mc1, d1h0md1 protein/DNA complex; complexed with lae |
PDB Entry: 1h0m (more details), 3 Å
SCOPe Domain Sequences for d1h0mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0mc2 d.110.5.1 (C:1-164) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt angfmsmftmasdkpvidldreidavaaaatigqiharisflrt
Timeline for d1h0mc2: