Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries) |
Domain d1h0ma1: 1h0m A:170-234 [76442] Other proteins in same PDB: d1h0ma2, d1h0mb2, d1h0mc2, d1h0md2 complexed with hsl, ooa |
PDB Entry: 1h0m (more details), 3 Å
SCOPe Domain Sequences for d1h0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0ma1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} daawldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalai rrkli
Timeline for d1h0ma1: