SCOPe 2.06: Domain d1gzsd_: 1gzs D:

Lineage for d1gzsd_ (1gzs D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
   multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist

4. Superfamily a.168.1: SopE-like GEF domain [81832] (1 family)

5. Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins)
   C-terminal part of Pfam PF05364

6. Protein GEF domain of SopE toxin [81834] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [81835] (1 PDB entry)

8. Domain d1gzsd_: 1gzs D: [76427]
   Other proteins in same PDB: d1gzsa_, d1gzsc_
   complexed with so4

Details for d1gzsd_

PDB Entry: 1gzs, 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42

PDB Compounds: (D:) sope

SCOPe Domain Sequences for d1gzsd_:

Sequence; same for both SEQRES and ATOM records:

>d1gzsd_ a.168.1.1 (D:) GEF domain of SopE toxin {Salmonella typhimurium [TaxId: 90371]}
sltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgin
iapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqas
fkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp

Timeline for d1gzsd_:

• d1gzsd_ first appeared in SCOP 1.63
  
• d1gzsd_ appears in SCOPe 2.05
  
• d1gzsd_ appears in SCOPe 2.07
  
• d1gzsd_ appears in the current release, SCOPe 2.08