Lineage for d1gzsd_ (1gzs D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545604Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
    multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist
  4. 545605Superfamily a.168.1: SopE-like GEF domain [81832] (1 family) (S)
  5. 545606Family a.168.1.1: SopE-like GEF domain [81833] (2 proteins)
    C-terminal part of Pfam 05364
  6. 545611Protein GEF domain of SopE toxin [81834] (1 species)
  7. 545612Species Salmonella typhimurium [TaxId:90371] [81835] (1 PDB entry)
  8. 545614Domain d1gzsd_: 1gzs D: [76427]
    Other proteins in same PDB: d1gzsa_, d1gzsc_
    complexed with so4

Details for d1gzsd_

PDB Entry: 1gzs (more details), 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42

SCOP Domain Sequences for d1gzsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzsd_ a.168.1.1 (D:) GEF domain of SopE toxin {Salmonella typhimurium}
sltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgin
iapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqas
fkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp

SCOP Domain Coordinates for d1gzsd_:

Click to download the PDB-style file with coordinates for d1gzsd_.
(The format of our PDB-style files is described here.)

Timeline for d1gzsd_: