SCOPe 2.03: Domain d1gzsb_: 1gzs B:

Lineage for d1gzsb_ (1gzs B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.168: SopE-like GEF domain [81831] (1 superfamily)
   multihelical; consists of two all-alpha subdomains each containing a 3-helical bundle with right-handed twist

4. Superfamily a.168.1: SopE-like GEF domain [81832] (1 family)

5. Family a.168.1.1: SopE-like GEF domain [81833] (3 proteins)
   C-terminal part of Pfam PF05364

6. Protein GEF domain of SopE toxin [81834] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [81835] (1 PDB entry)

8. Domain d1gzsb_: 1gzs B: [76425]
   Other proteins in same PDB: d1gzsa_, d1gzsc_
   complexed with so4

Details for d1gzsb_

PDB Entry: 1gzs, 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42

PDB Compounds: (B:) sope

SCOPe Domain Sequences for d1gzsb_:

Sequence; same for both SEQRES and ATOM records:

>d1gzsb_ a.168.1.1 (B:) GEF domain of SopE toxin {Salmonella typhimurium [TaxId: 90371]}
gsltnkvvkdfmlqtlndidirgsaskdpayasqtreailsavysknkdqccnlliskgi
niapflqeigeaaknaglpgttkndvftpsgaganpfitplissanskyprmfinqhqqa
sfkiyaekiimtevaplfnecamptpqqfqlileniankyiqntp

Timeline for d1gzsb_:

• d1gzsb_ first appeared in SCOP 1.63
  
• d1gzsb_ appears in SCOPe 2.02
  
• d1gzsb_ appears in SCOPe 2.04
  
• d1gzsb_ appears in the current release, SCOPe 2.08