Lineage for d1gz0h1 (1gz0 H:78-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528468Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 2528473Protein RlmB, C-terminal domain [82376] (1 species)
    23S rRNA G2251 2'O-methytransferase
  7. 2528474Species Escherichia coli [TaxId:562] [82377] (1 PDB entry)
  8. 2528482Domain d1gz0h1: 1gz0 H:78-243 [76403]
    Other proteins in same PDB: d1gz0a2, d1gz0b2, d1gz0b3, d1gz0c2, d1gz0d2, d1gz0d3, d1gz0f2, d1gz0f3, d1gz0h2, d1gz0h3

Details for d1gz0h1

PDB Entry: 1gz0 (more details), 2.5 Å

PDB Description: 23s ribosomal rna g2251 2'o-methyltransferase rlmb
PDB Compounds: (H:) hypothetical tRNA/rRNA methyltransferase yjfh

SCOPe Domain Sequences for d1gz0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz0h1 c.116.1.1 (H:78-243) RlmB, C-terminal domain {Escherichia coli [TaxId: 562]}
rqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagvhavivpkdrsaqlnat
akkvacgaaesvplirvtnlartmrmlqeeniwivgtageadhtlyqskmtgrlalvmga
egegmrrltrehcdelisipmagsvsslnvsvatgiclfeavrqrs

SCOPe Domain Coordinates for d1gz0h1:

Click to download the PDB-style file with coordinates for d1gz0h1.
(The format of our PDB-style files is described here.)

Timeline for d1gz0h1: