Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.3: Ecto-ART [82814] (1 protein) the two disulfide bridges and N-terminal alpha helices are characteristic for all ecto-ARTs automatically mapped to Pfam PF01129 |
Protein Eukaryotic mono-ADP-ribosyltransferase ART2.2 [82815] (1 species) NAD glycohydrolase and auto-ADP-ribosylation activity |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [82816] (6 PDB entries) |
Domain d1gxyb_: 1gxy B: [76381] complexed with gol |
PDB Entry: 1gxy (more details), 1.71 Å
SCOPe Domain Sequences for d1gxyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxyb_ d.166.1.3 (B:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf rpdqeevlipgyevyqkvrtqgyneifldspkrkksnynclys
Timeline for d1gxyb_: