SCOP 1.63: Domain d1gxyb_: 1gxy B:

Lineage for d1gxyb_ (1gxy B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (3 families)

5. Family d.166.1.3: Ecto-ART [82814] (1 protein)

6. Protein Eucaryotic mono-adp-ribosyltransferase ART2.2 [82815] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [82816] (3 PDB entries)

8. Domain d1gxyb_: 1gxy B: [76381]
   complexed with gol

Details for d1gxyb_

PDB Entry: 1gxy, 1.71 Å

PDB Description: crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2; crystal form a (p21)

SCOP Domain Sequences for d1gxyb_:

Sequence; same for both SEQRES and ATOM records:

>d1gxyb_ d.166.1.3 (B:) Eucaryotic mono-adp-ribosyltransferase ART2.2 {Rat (Rattus norvegicus)}
plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy
pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs
vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf
rpdqeevlipgyevyqkvrtqgyneifldspkrkksnynclys

Timeline for d1gxyb_:

• d1gxyb_ is new in SCOP 1.63
  
• d1gxyb_ appears in SCOP 1.65
  
• d1gxyb_ appears in the current release, SCOPe 2.08