SCOP 1.67: Domain d1gxya_: 1gxy A:

Lineage for d1gxya_ (1gxy A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (3 families)

5. Family d.166.1.3: Ecto-ART [82814] (1 protein)
   the two disulfide bridges and N-terminal alpha helices are characteristic for all ecto-ARTs

6. Protein Eukaryotic mono-ADP-ribosyltransferase ART2.2 [82815] (1 species)
   NAD glycohydrolase and auto-ADP-ribosylation activity

7. Species Rat (Rattus norvegicus) [TaxId:10116] [82816] (6 PDB entries)

8. Domain d1gxya_: 1gxy A: [76380]

Details for d1gxya_

PDB Entry: 1gxy, 1.71 Å

PDB Description: crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2; crystal form a (p21)

SCOP Domain Sequences for d1gxya_:

Sequence; same for both SEQRES and ATOM records:

>d1gxya_ d.166.1.3 (A:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Rat (Rattus norvegicus)}
plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy
pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs
vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf
rpdqeevlipgyevyqkvrtqgyneifldspkrkksnynclys

Timeline for d1gxya_:

• d1gxya_ first appeared in SCOP 1.63
  
• d1gxya_ appears in SCOP 1.65
  
• d1gxya_ appears in SCOP 1.69
  
• d1gxya_ appears in the current release, SCOPe 2.08