Lineage for d1gxoa_ (1gxo A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216584Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 216585Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomlete toroid made of four haipins
  6. 216586Protein Polygalacturonic acid lyase (pectate lyase) [81855] (1 species)
  7. 216587Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 216591Domain d1gxoa_: 1gxo A: [76374]
    complexed with ada, ca; mutant

Details for d1gxoa_

PDB Entry: 1gxo (more details), 2.05 Å

PDB Description: mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid

SCOP Domain Sequences for d1gxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxoa_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa}
rmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesgti
angatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdhat
fndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvltv
wcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsprt
ylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerrtg
yswggnygtsiinfaqkvgy

SCOP Domain Coordinates for d1gxoa_:

Click to download the PDB-style file with coordinates for d1gxoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gxoa_: