Lineage for d1gxmb_ (1gxm B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284488Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 284489Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomlete toroid made of four haipins
  6. 284490Protein Polygalacturonic acid lyase (pectate lyase) [81855] (1 species)
  7. 284491Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 284493Domain d1gxmb_: 1gxm B: [76372]
    complexed with gol

Details for d1gxmb_

PDB Entry: 1gxm (more details), 1.32 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa

SCOP Domain Sequences for d1gxmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxmb_ a.102.5.1 (B:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa}
glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
itqmslerrtgyswggnygtsiinfaqkvgyl

SCOP Domain Coordinates for d1gxmb_:

Click to download the PDB-style file with coordinates for d1gxmb_.
(The format of our PDB-style files is described here.)

Timeline for d1gxmb_: