Lineage for d1gxma1 (1gxm A:327-649)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2336014Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 2336015Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 2336016Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 2336019Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 2336020Domain d1gxma1: 1gxm A:327-649 [76371]
    Other proteins in same PDB: d1gxma2, d1gxmb2
    complexed with gol

Details for d1gxma1

PDB Entry: 1gxm (more details), 1.32 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d1gxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxma1 a.102.5.1 (A:327-649) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}
tgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesg
tidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdh
atfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvl
tvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsp
rtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerr
tgyswggnygtsiinfaqkvgyl

SCOPe Domain Coordinates for d1gxma1:

Click to download the PDB-style file with coordinates for d1gxma1.
(The format of our PDB-style files is described here.)

Timeline for d1gxma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gxma2