Lineage for d1gwrb_ (1gwr B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217450Protein Estrogen receptor alpha [48519] (1 species)
  7. 217451Species Human (Homo sapiens) [TaxId:9606] [48520] (11 PDB entries)
  8. 217461Domain d1gwrb_: 1gwr B: [76369]
    complex with 17beta-oestradiol and TIF2 NRbox3 peptide; chains C and D
    complexed with est

Details for d1gwrb_

PDB Entry: 1gwr (more details), 2.4 Å

PDB Description: human oestrogen receptor alpha ligand-binding domain in complex with 17beta-oestradiol and tif2 nrbox3 peptide

SCOP Domain Sequences for d1gwrb_:

Sequence, based on SEQRES records: (download)

>d1gwrb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahr

Sequence, based on observed residues (ATOM records): (download)

>d1gwrb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
slalsltadqmvsalldaeppilyseydppfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihl
makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr

SCOP Domain Coordinates for d1gwrb_:

Click to download the PDB-style file with coordinates for d1gwrb_.
(The format of our PDB-style files is described here.)

Timeline for d1gwrb_: