Lineage for d1gwra_ (1gwr A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543453Protein Estrogen receptor alpha [48519] (1 species)
  7. 543454Species Human (Homo sapiens) [TaxId:9606] [48520] (19 PDB entries)
  8. 543469Domain d1gwra_: 1gwr A: [76368]

Details for d1gwra_

PDB Entry: 1gwr (more details), 2.4 Å

PDB Description: human oestrogen receptor alpha ligand-binding domain in complex with 17beta-oestradiol and tif2 nrbox3 peptide

SCOP Domain Sequences for d1gwra_:

Sequence, based on SEQRES records: (download)

>d1gwra_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
ahrl

Sequence, based on observed residues (ATOM records): (download)

>d1gwra_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
lalsltadqmvsalldaeppilyseyrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlma
kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrl

SCOP Domain Coordinates for d1gwra_:

Click to download the PDB-style file with coordinates for d1gwra_.
(The format of our PDB-style files is described here.)

Timeline for d1gwra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gwrb_