SCOP 1.75: Domain d1gu2b_: 1gu2 B:

Lineage for d1gu2b_ (1gu2 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c'' [68950] (1 species)
   close homologue of SHP

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (3 PDB entries)

8. Domain d1gu2b_: 1gu2 B: [76349]
   complexed with hec

Details for d1gu2b_

PDB Entry: 1gu2, 1.19 Å

PDB Description: crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus

PDB Compounds: (B:) cytochrome c''

SCOP Domain Sequences for d1gu2b_:

Sequence; same for both SEQRES and ATOM records:

>d1gu2b_ a.3.1.1 (B:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kpt

Timeline for d1gu2b_:

• d1gu2b_ first appeared in SCOP 1.63
  
• d1gu2b_ appears in SCOP 1.73
  
• d1gu2b_ appears in SCOPe 2.01
  
• d1gu2b_ appears in the current release, SCOPe 2.08